Sh_019O15_p000080

Overview
NameSh_019O15_p000080
Unique NameSh_019O15_p000080
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length492
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_019O15contigSh_019O15:99794..101269
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR002293
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_019O15_t000080Sh_019O15_t000080R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_019O15_p000080 ID=Sh_019O15_p000080|Name=Sh_019O15_p000080|organism=R570 Sugarcane cultivar|type=polypeptide|length=492bp
MGDRVGINYSSVSEGKECKGGHGIPKLSMVPLVFLIFYEVSGAPFGIEDS
VRAAGPLLAIVGFLLFALIWSILEALLTAEMGTMFPENGGYVVRVSSALG
PFWGFQQRWAKWLSGVIDNALYPVLVLDYLKSSVPALGGGMPRTLEVLIF
AVALTYMNYTGLTVIGWVAVFLGVFSLLPFLVMGLVAIPRIEPSRWIQIE
LGSVDLRLYLNTLFWNLNYWDSISTLTGEVENPKRTLPKALSYALVLVVG
GYLYPLITCTAAVPVVREYWSDGYFSDIARILGGVWLQSWMQAVAALSNV
GNFLTEMSSDSYQLLGMAERGMLPEFFAKRSRHGTPLTSILFSASRVILL
SWMSFQEIVATENYLYCFGMILQFIAFVKLRVTHPNATRAYKVPLGTIDV
VLMIIPPTLLIVVVMALASYNVMAVSIVVMVVGFVLQPGLVYVEKKRWLR
FSISADLPDLPDTQETAEDDATQDILGRIVTHWDPQPISPE*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0015171amino acid transmembrane transporter activity
Vocabulary: Biological Process
TermDefinition
GO:0003333amino acid transmembrane transport
Vocabulary: Cellular Component
TermDefinition
GO:0016020membrane