Sh_019O15_p000090

Overview
NameSh_019O15_p000090
Unique NameSh_019O15_p000090
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length802
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_019O15contigSh_019O15:121817..124434
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR001207
InterProIPR007527
InterProIPR018289
InterProIPR004332
InterProIPR006564
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_019O15_t000090Sh_019O15_t000090R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_019O15_p000090 ID=Sh_019O15_p000090|Name=Sh_019O15_p000090|organism=R570 Sugarcane cultivar|type=polypeptide|length=802bp
MVATKRRLTDRPPEYGFGELWNCLLLLQSDDLCSIDLVVTLIFCRNLGDD
DEEFTVELHHGGFFVGQGSNKSYLNGKVDHFDHCEVDTWSLIEIEEFLRD
LHYPNEPKRQVYWLLPGLEVPQGLRIVGSDTEIIVMQSLVHEVKNFVLYI
DHDGTFCGMDWDDIVVNPVATLPKVLSPKKVAHERRKEGEKLPHFYSDLK
RASEEIDGDNDVEASGDEDDPDFVDSEYEVDDGDDDLFNDNVDEGATDDG
YKFSKGNKIDRSTNADGDDTTDDGECLDLPDSEGEGEVRMGFQSFKDSDL
SNPRFKVGLAFDSVVELKRAITEYSVKERVDITWKRNTRKRLHAICDKDC
TWELYGSVDVRSPTMVIKRYCGRHTCHRKWSVKRCTSKWLSEKYIESFRA
DQKMSLTNFARTVQKEWNLTPSRSKLARAKRLAMKKVMGDEVEQYSMLWD
YGHELRRSNPGTSFFINLNGNLFSSLYMSLDACKRGFLAACRPIICLDGC
HIKTKYGGIILTAVGIDPNDCIFPIAWAIVEVECLLSWKWFLLTLKQDLG
IENTCPWTIMTDKQKGLIPAVQQVFPESEHRFCVRHLYNNFQQYFKGENL
KNQLWTCARSSSVVQWNRNMDKMRALDRKAFAWLEKMPPQTWCRAFFSTF
PKCDILLNNACEVFNNYILEAREMPVLSMLETIRCKLMSRFYNKEKEVGE
QWFGAVCPKIRKKLQKNTEWSNICYALPSGQGIFQVQAREYSFIVDINAK
TCSCRRWDLTGIPCSHAIYEVARQGSVAAVRRGSMAERGGLGARRPDGTH
P*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0003677DNA binding
GO:0004803transposase activity
GO:0008270zinc ion binding
Vocabulary: Biological Process
TermDefinition
GO:0006313transposition, DNA-mediated