Sh_020B23_contig-2_p000040

Overview
NameSh_020B23_contig-2_p000040
Unique NameSh_020B23_contig-2_p000040
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length564
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_020B23_contig-2contigSh_020B23_contig-2:37684..39375
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR011990
InterProIPR002885
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_020B23_contig-2_t000040Sh_020B23_contig-2_t000040R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_020B23_contig-2_p000040 ID=Sh_020B23_contig-2_p000040|Name=Sh_020B23_contig-2_p000040|organism=R570 Sugarcane cultivar|type=polypeptide|length=564bp
MRGNLPFLAAAAAASNGAALTLSLSHTKQLHARLIVASPSSASGPADFRL
LVLRSYAARGDLSSARRLLDEAPRPASPLLYNALIRAHARRLDLPAALAL
FARMRRSATPPDAHTFACVLRACAESSRPDAVKVVHGVATSCGMCSRPIV
LSALVSGYAKVGLVDNARSVFDGLCEPDLVLWNSMMSAYGYQGMWYDGLQ
MFSLMRRAGEQPDGYSMVGLISCFWNPEILAFGQAVHAMCVKGGYDSGHH
VRSTLVSMYMRCGSMESGQSLFGSLPDADLITWSSLITGLMQTGKYEESF
DLFRRMCFTGRRPDGILIACVLSVCASTAAVSCTREVHCYAVRLRVDMDI
RVSSSLMDAYAKCGFTELGYWVFRQLPNKNSVMYNTVISKLGSHGFATKA
IEVLDEMVNDKLRPDSATFSALLAACCHVGHLEEGWKLFRRMRDEFKIVV
EVEHYVYMVRLLATFGQLKEAYDLIQTTQIQPDCGVWGALLWGCCVHRYS
SLGRIVAEKLFELNSEKAAYSVMLSNLYASQEMWWDAEEVRDELSKENMY
KNTGMSWIGKVKI*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0005515protein binding