Sh_020B23_contig-5_p000010

Overview
NameSh_020B23_contig-5_p000010
Unique NameSh_020B23_contig-5_p000010
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length325
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_020B23_contig-5contigSh_020B23_contig-5:1..977
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_020B23_contig-5_t000010Sh_020B23_contig-5_t000010R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_020B23_contig-5_p000010 ID=Sh_020B23_contig-5_p000010|Name=Sh_020B23_contig-5_p000010|organism=R570 Sugarcane cultivar|type=polypeptide|length=325bp
CVKGGYDSGHHVRSTLVSMYMRCGSMESGQSLFGSLPYADLITWSSLITG
LMQTGKYEESFDLFRRMCFTGRRPDGILIACVLSVCASTAAVSCTREVHC
YAVRLRVDMDIRVSSSLMDAYAKCGFTELGYWVFRQLPNKNSVMYNTVIS
KLGSHGFATKAIEVLDEMVNDKLRPDSATFSALLAACCHVGHLEEGWKLF
RRMRDEFKIVVEVEHYVYMVRLLATFGQLKEAYDLIQTTQIQPDCGVWGA
LLWGCCVHRDSSLGRIVAEKLFELNSEKAAYRVMLSNLYASQEMWWDAEE
VRDELSKENMYKNTGMSWIGKVKI*
back to top