Sh_020D07_p000040

Overview
NameSh_020D07_p000040
Unique NameSh_020D07_p000040
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length217
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_020D07contigSh_020D07:24875..25525
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_020D07_t000040Sh_020D07_t000040R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_020D07_p000040 ID=Sh_020D07_p000040|Name=Sh_020D07_p000040|organism=R570 Sugarcane cultivar|type=polypeptide|length=217bp
MRVYLYSWIGQCLIGHRNSAPSPPSPAARAPPPARQAAAVARHWPAGAAP
VARRCAGGPPTGAGRRPARVRVLVWASDGDHWHALRRLLVVELSGSSDVA
KHRLEILKLTRKDPSSSHSGKATAVAAVAAITVVLPWRATRLLAAAVHRS
TRSALAAVRTLPAPAGSIAACLMRTDVCSFDEDEEGDSSGSDVEVVVVDS
GEEMQWESMFHDIKPT*
back to top