Sh_020D07_p000090

Overview
NameSh_020D07_p000090
Unique NameSh_020D07_p000090
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length51
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_020D07contigSh_020D07:44451..44603
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_020D07_t000090Sh_020D07_t000090R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_020D07_p000090 ID=Sh_020D07_p000090|Name=Sh_020D07_p000090|organism=R570 Sugarcane cultivar|type=polypeptide|length=51bp
MMPLFKFGDKQYIAMVANMNLIVLVSHRFLQYELDCFSFASKLGVVFYRG
*
back to top