Sh_020D07_p000100

Overview
NameSh_020D07_p000100
Unique NameSh_020D07_p000100
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length219
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_020D07contigSh_020D07:64343..64999
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR013083
InterProIPR001841
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_020D07_t000100Sh_020D07_t000100R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_020D07_p000100 ID=Sh_020D07_p000100|Name=Sh_020D07_p000100|organism=R570 Sugarcane cultivar|type=polypeptide|length=219bp
MDCFVRLFGLAIANAVCIGGTGLLINSLIRHARKPHSTSDMVTLSIFFVF
WVSISACVYPAICGALFPWSALGRFLRSPLRGLAWLLCLPCRCARTARAR
LRHRSSGGASAASGSLPRFVVQGRQEGHAAIYVLAREPPVRGGARVVAVD
DIPAYEQEPDGVSECAVCLAEVEKGEMVKRLPGCLHMFHQQCIDLWLRDH
STCPVCRYNVFSTVLQVA*
back to top