Sh_020D07_p000110

Overview
NameSh_020D07_p000110
Unique NameSh_020D07_p000110
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length184
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_020D07contigSh_020D07:66422..68017
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR016087
InterProIPR016088
InterProIPR016089
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_020D07_t000110Sh_020D07_t000110R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_020D07_p000110 ID=Sh_020D07_p000110|Name=Sh_020D07_p000110|organism=R570 Sugarcane cultivar|type=polypeptide|length=184bp
MFSDLTLISLSGYRDKFFVKVYAAAFYVDYSLRLDTEQWKEKIGIESFDG
SSVFYSIFKAPVVKSLSIILVRAVDGKTFVNALNDVIARQIKNPNAEEES
SLSTLQNTFLGRNLKQGTSIYLTWLEPKRMLISISENQDPRQVDAEIESA
TVNYALYDGFFGKSPVSPSLRSSTAQLLEALLL*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0016872intramolecular lyase activity
GO:0045430chalcone isomerase activity
Vocabulary: Biological Process
TermDefinition
GO:0009813flavonoid biosynthetic process