Sh_020L05_contig-1_p000020

Overview
NameSh_020L05_contig-1_p000020
Unique NameSh_020L05_contig-1_p000020
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length3009
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_020L05_contig-1contigSh_020L05_contig-1:29495..44100
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR001650
InterProIPR027417
InterProIPR012337
InterProIPR022707
InterProIPR013103
InterProIPR001584
InterProIPR021133
InterProIPR011989
InterProIPR016024
InterProIPR014001
InterProIPR000357
InterProIPR000330
InterProIPR025724
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_020L05_contig-1_t000020Sh_020L05_contig-1_t000020R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_020L05_contig-1_p000020 ID=Sh_020L05_contig-1_p000020|Name=Sh_020L05_contig-1_p000020|organism=R570 Sugarcane cultivar|type=polypeptide|length=3009bp
RSAPTAVHLDEPRAQVLLGAAGDDAEPRWYLDSGASNHMTGCRAVFSELD
ERHAGSVRFGDGSRVQIRGRGTVLFRCKNGDHRALTDVYYIPELRSSIVS
LGQLDEHGAEVLIGNGVLRIRDQDGRLLAKVSRSQNRLYLLDLKVEQPVC
LAASCSVEPWLWHGRFGHLSFDALGRLGKMVTGLPQIKHAGELCDSCLAG
KQRRLPFPKAARFRAADPLELVHGDLCGPITPATHGGRRYFLLLVDDCSR
YMWLQLLTSKSDAADAIRRFKARAEVESGKKLRVLRTDRGGEFTAVEFAT
YCADEGVGRHHTAPYSPQQNGVVERRNQTIVGMARSMMKAKGMPAAFWGE
AVTTAVFILNRSPTKALKGMTPYEAWYGRKPNVSYLRTFGCIGHVKATKP
GLGKLEDRSTRMVFLGYEDGSKAYRLYDPVGGKVVVSRDVVFNEAAAWSW
DGPEAEEGQGSGGFCNTFVVERLVIHSHGEAVEPPVAGEAQGPEPAVAEA
EPPATAEGEPLSPGGAGHLSSPGPIGEQSPASPELGTPAAGATIEYASPP
SDVSDFVDAFHEGEEVRFRRVDNVVGEATVPGLAARMLDDADQTLLLMSA
EEPATFAVAERDAAWRKAMLEEMKAIEDNHTWELVDPPATCRPIGLKWVF
KVKRDERGAVVKHKARLVARGFVQREGVDFEEVFAPVARMESVRLLLALA
AAKDWPVHHLDVKSAFLNGDLAETVFVKQPPGFVVKGAERKVLRLRKALY
GLRQAPRAWNAKLDATMAELGFIRCATEHALYTRRRGKEHLIVGVYVDDL
IVTGARAEDIGRFKEEMAARFRMSDLGALSYYLGIEVRQGKDVIRLGQHA
YALKLLERAGMAGCKAVATPMEERIKLSKQSTAAKVDATLYRSIVGGLRW
LTHTRPDIAFAVGYVSRFMEDPREDHWAAVKRLLRYVQGTAELGIVFPKR
GGIQLSAFSEAPPKASKDAALTVFSDADMAGDVDGRRSTSGVLVFLGSSP
IAWQSLKQKMVALSTCEAEYVAAATAACQVVWLRRLLAELTGAQVQPPAL
KVDNQPAIALAKNPVLHDRSKHIDVKFHFLRDCVDGGQLVIEFVDTRRQL
ADILTKSLGRLRFQELRRMIGMVEVNAGLDVCEQFMDVSDVIKDEDLLAQ
KNYWGSPVQNNGFHSFNSGRNIQQLVSTMVPRYPKHSNFRSRRLSARELN
MLKRKAKSNAKDHTKAVSEDDEVTLKGSVPSNGASSEQADAQNDVFDTAV
DEDNLEYSENGRWPFQQFVDQLIHDMFDPIWEVRHGSIMALREILTHHGA
CAGVYFPDLSLPSADLVGKTNFDSLKREHGIDLNEDVRVEHLEPALKRHK
KEPNCSESVYMDYGKELVDSDYPKTEGDPSNVPDVLTGEPSSTHVKVEPE
LVVDDSTDPSKGDSTCKSLQEKLNSISHPSSHIHAPENSKFMKLLKLAKY
SYMKNWEFLQDCAIRFLCVLSLDRFGDYVSDQVVAPVRETCAQALGAVLK
YMHPSLVCHTFKILLEMQRRQEWEVRHGSLLGIKYLVAVRQEMLQDLLDY
IIHACKAGLEDPDDDVRAVAAEALIPAADSLVRLNDQILRPIVMLLWDIL
LDLDDLSPSTSSVMNLLAEIYSRPEMVPKMLGTAASGEKGEFDLNEATQI
AEQEDRLTSIENPYGLATLTPRLWPFMRHSITSVRRSAIRTLEKLLEVGN
TRSSAGTTPSKLWPTSILGDALQVVFQNLLLESNDDILQSSERAWKLLLQ
CPEKDLEYAARLYFSNWVQLATTPFGSALDSTKMFLPVALPRGNRSRAAA
KIRSARLDHEYTRMISFGSTGESTSHEKHLDVPSSVSKIIVGADPDKSVT
HTRVLTSMALGLFASKLPVSSWQVVLSPLANDLMSLSGVQRQVASMIIVS
WFKDLRGRDPVSVGTLLAFLSSLKEWLLDLLTCSDPALPTKDSVLPYSEL
SRTYTKMRNEANNLLHSIDSCAAFKDYISSLNLNVDVLSVDDAINFASKL
LLPSESDLPSESEKIFLNNIESAKQGLLSTSGYLKCVQNNLHVTVSSLVA
SAVVWMSCLPSKLNPVILPLMAAIKREQEEVLQDKAADALAELIFSCVGR
KPGPNDKLTKNLCTLTCTDASETPQAAIINSMQVIEDQNLLSIGKRFSSH
RSRGHTTSGGDERSKMEGFISRRGSELAFKHLCEKFGPSLFEKLPKLWDC
LTEFLKPVKTEDGIPKDDASIAQLGRSYEDKDPQSLINNIQVVRSISPHL
AEPLRPQLLNLLPCILGCVRHPHVAVRLAAARCITSMAKSLTDDVMVLVI
ENVIPMLSDLSSVCARQGAGILLSLLVQGLAVELVPYAPFLVVPLLKCMS
DPDGSVRQTVTHSFAALVPLLPLSRGASLPGGLSERLSSSAEDVQFLEQL
LDSTQIDDFKLNIDLSVELRRYQQEGINWLAFLRRFKLHGILCDDMGLGK
TLQASAIVASDIAEARARNDDKSLTSLIICPSTLVAHWEYEIEKYIDTSI
LKPLQYVGSSQDRVTLRSQFDKVNVIITSYDIIRKDIDFLGNIPWNYCVL
DEGHIIKNSRSKITSAVKQLKAQHRLILSGTPIQNNVLELWSLFDFLMPG
FLGTEKQFQATYGKPLVAAKDSKCSAKDAEAGILAMEALHKQVMPFLLRR
TKDEVLSDLPEKIIQDRYCDLSLLQLKLYDKFSSSNAKEEISTIVKANES
QESAPQPKATRHVFQALQYLLKLCSHPLLVTGESPPNHLVDLLKEIGVGS
GSELHELHHSPKLVALQEILQECGIGSEISSPDASTAVGQHRVLIFAQHK
AFLDIIEKDLFQSHMRSVTYLRLDGSVDPEKRFEIVKAFNSDPTIDVLLL
TTHVGGLGLNLTSADTLVFMEHDWNPMKDLQAMDRAHRLGQRKVVNVHRL
IMRGTLEEKVMSLQRFKVSVANAVINAENSSLKTMNTDQLLDLFTSTPAS
RKASVLPRGSSDEQSKDSKRKSGGKGLKSILNGLDELWDQSQYADEYDLN
QFLAKLNG*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0003676nucleic acid binding
GO:0005488binding
GO:0005515protein binding
GO:0005524ATP binding
Vocabulary: Biological Process
TermDefinition
GO:0015074DNA integration