Sh_020L05_contig-2_p000030

Overview
NameSh_020L05_contig-2_p000030
Unique NameSh_020L05_contig-2_p000030
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length734
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_020L05_contig-2contigSh_020L05_contig-2:12376..16568
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR005936
InterProIPR003960
InterProIPR003593
InterProIPR027417
InterProIPR003959
InterProIPR000642
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_020L05_contig-2_t000030Sh_020L05_contig-2_t000030R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_020L05_contig-2_p000030 ID=Sh_020L05_contig-2_p000030|Name=Sh_020L05_contig-2_p000030|organism=R570 Sugarcane cultivar|type=polypeptide|length=734bp
MAWRLAISKAARLRSANAVYNQLVASSPLRAPRSDNAAGGMLRNLQERYR
SSYTGSFPRWIREMDFPSEASLLKQIYKSDPERVVQIFERHPSLHSNSAA
LSEYIKALVSLDRLEDSPLLKTLQRGFASSTIEEERRTGLAAFGSLGRRT
KDGALGTANAPIHMVTAGTGQFKEQLWKTFRSIALTFLVISGIGALIEDR
GISKGLGLNEEVRPSVDSSTKFSDVKGVDEAKAELEEIVHYLRDPKRFTR
LGGKLPKGVLLVGPPGTGKTMLARAIAGEAGVPFFSCSGSEFEEMFVGVG
ARRVRDLFNAAKKRSPCIIFIDEIDAIGGSRNPKDQQNPKDQQYMKMTLN
QLLVELDGFKQNDGIIVIAATNFPQSLDKALVRPGRFDRHIVVPNPDVEG
RRQILETHMSKVLRAEDVDLMTIARGAPGFSGADLANLVNVAALRAAMDG
AKAVTMQDLEYAKDRIMMGSERKSAVISDESRKLTAYHEGGHALVAIHTE
GAHPVHKATIVPRGVSLGMVTQLPEKDQHSISRKQMLARLDVCMGGRVAE
ELIFGESEVTSGASSDLKNATRLARAMVTKYGMSKRVGLVSYSDNNGNSM
SGQTSGVIDKEVKEILEKAYNNAKSILTTHDKELHALANALLEHETLSGA
QIKKILAQVDKSDNKQKKAAKVPQKTPAASAPPQSPPPAAAAAAAAAAAA
QEAAAKAKGVAGTAAAAQEAATANAKGVAGVGS*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0004222metalloendopeptidase activity
GO:0005524ATP binding
Vocabulary: Cellular Component
TermDefinition
GO:0016020membrane
Vocabulary: Biological Process
TermDefinition
GO:0006508proteolysis