Sh_020L05_contig-3_p000010

Overview
NameSh_020L05_contig-3_p000010
Unique NameSh_020L05_contig-3_p000010
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length1318
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_020L05_contig-3contigSh_020L05_contig-3:1333..5418
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR012337
InterProIPR025724
InterProIPR013103
InterProIPR001584
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_020L05_contig-3_t000010Sh_020L05_contig-3_t000010R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_020L05_contig-3_p000010 ID=Sh_020L05_contig-3_p000010|Name=Sh_020L05_contig-3_p000010|organism=R570 Sugarcane cultivar|type=polypeptide|length=1318bp
MAQNPQFSPIVINITLDGSNYPEWSFCVETALRGHGLYSHLTDNPPELKS
DGSNASAVTAWQTNDGKVMAAMINSTKPSMIMSLRKFKTAKAIWSALKKR
YVQDSSALLHNLMQQIHDIEQAADMSIDDYYSAYDRLMGSLISMVPDCTA
ADCPAHTFIEKFLTYRFVMGVKPEFDSIRTRLLHNSSNLTMDQALAELLA
EETRLKSLSSFSSMTVSHSVLAASQRNTVPKATSSEPCKHCGKTTHISEN
CFSAYPEKLAEYRARRAARATRGRGTSSTARGGSVSIAAASPIGASQPAW
VLDSGASFHVTSDHSQLVSSKPITGGASIQTADGTSCYITHQGTLCSTNF
SVPDVSFVPQLSMNLLSVGQIADHNCFIGFDDSSCFIQDRQSGTVIGTGH
RRRGSPSLYILDTLRLPSSAACVSTVASSSTSSFAKWHHRLGHLCGSRLS
TLIHQGYLGHTSVESHFHCKGCKLGKQIQLPYPSSVSHAARPFDLIHSDV
WGPAPFATKGGHKYYVIFVDDHSRYTWLYFMKHRSQLCSIYQSFTRMVHT
QFSTSIKIFRSDSGGEYLSDRFRQFLTSEGTLPQLSCPGAHPQNGVAERK
HRHIIETARTLLIASFVPSHFWGEAVSTSVYLINRQPSSKLSGKCPGEVL
FGTPPHYDHLRVFGCTCYVLLAPRERTKLTAQSVECVFLGYSPEHKGYRC
YDPSTRRIRISRDVTFVEDRPFFYNPSTQSSSSSTESTSFLYLPPILPSD
DVPSSTPSPSHDPPPILAPQSPPPRPLSCKPPITRVYTRRSTNPIEPPST
SSSSASPDAPVLVDSNASDESQAAMSEELAALERTGTWDIVPLPPHTVPI
TCKWVFKVKTKSDGSIERYKARLVARGFQQAQGRDYDETFAPVAHMTTVR
TLIAVAASKSWNISQMDVKNAFLHGDLHEEVYMQPPPGVDAPSGHVCRLR
RALYGLKQAPRAWFERFVSVIQDAGFSPSDHDPALFIHLSPRGRTLLLLY
VDDMLITGDDMDYISHVKEQLSKQFQMSDLGPLSYFLGIEVLHSSKGYYL
SQSKYIHDLIARSGISDNRTAATPMDLHLQLRPTDGTPLEDPSRYRHIVG
SLVYLTVTRPDIAHAVHILSQFVSAPTSVHFGHLLRVLRYLRGTSSQCLF
YARDSPLHLYAYSDSTWASNPTDRCSVTGYCIFLGSSPLVWKSKKQSAVS
RSSTEAELRALATTTSEIIWLRWLLADFGVSCDAPTPLLCDNTGAIQIAN
DPVKHELTKHIGVDAFFTRSHCHQKTIALQYVPSELQVADLFTKAQTREQ
HRLHMLKLNASHPPPPP*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0003676nucleic acid binding
Vocabulary: Biological Process
TermDefinition
GO:0015074DNA integration