Sh_020L15_p000070

Overview
NameSh_020L15_p000070
Unique NameSh_020L15_p000070
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length350
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_020L15contigSh_020L15:53823..55915
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR000504
InterProIPR027450
InterProIPR005123
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_020L15_t000070Sh_020L15_t000070R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_020L15_p000070 ID=Sh_020L15_p000070|Name=Sh_020L15_p000070|organism=R570 Sugarcane cultivar|type=polypeptide|length=350bp
MAAKSGYTRPLPLAGDTAPPPPSAVLYVANCGPAVGVTDADVRSAFGAFG
EVAGVQAADDSGARTIVRFHEPGAAEAAMAALHGRPCDLLTGRVLHIRYS
VPVKPKARSGGSVPVALAASELGIPGIYMVQEFVTAAEEQELLSAVDSKT
WKRLAKRRVQHYGYEFLYETRNIDSKQFLGELPTFVSTVLDKIASFPGVK
DCTTRLVDQLTVNEYPCGVGLSPHIDTHSAFEEMIFSLSLSGPCIMEFRK
YTKGSWRAPSVVNGVDEDSSQEPECIRKAIFLPPRSMLLMSGEGRYAWHH
YIPHHKIDAVGGQVIKRNSRRVSFTFRKVRMGPCDCEYKQFCDSHSKRC*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0003676nucleic acid binding
GO:0016491oxidoreductase activity
Vocabulary: Biological Process
TermDefinition
GO:0055114oxidation-reduction process