Sh_020L15_p000100

Overview
NameSh_020L15_p000100
Unique NameSh_020L15_p000100
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length785
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_020L15contigSh_020L15:62947..68636
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
EC2.7.12.1
InterProIPR000719
InterProIPR017441
InterProIPR011009
InterProIPR008271
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_020L15_t000100Sh_020L15_t000100R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_020L15_p000100 ID=Sh_020L15_p000100|Name=Sh_020L15_p000100|organism=R570 Sugarcane cultivar|type=polypeptide|length=785bp
MEESGGTSGRREDAAPPWRPSEATAFGRFAAAAASSEAFPSASANGATAR
VSSLHGVKRKPFVARLTAGIIQTYLQCDPEFKYSEVLNPKRFLTSPSTPA
HNDGLDNANWDLILYVNLELVNKMSNRRFIVKEMLGQGTFGQVVKCWDTE
TNDYVAVKVIKNQPAFYHQAIMEVSLLRTLNQKFDPDDQHNIVRMLDYLS
FQNHLCIAFEMLGQNLYELLKRNHLRGLKLKYVQAFSKQILDAMVVMREA
GIIHCDLKPENILLAPSVATAAAVKVIDFGSACLEGKTVYSYIQSRYYRS
PEVLLGYPYTTAIDMWSFGCIVAELFLGLPLFPGASEYDVLQRMMKILRG
QPPDELLRGAKNTIRFFKHAGSICPGNEAPTGLSSAYRILSEEEVEVRDS
KRPKMGKWYFPHLKLDKLICTYPWNNSELTETEKTVRLGLVDFLKGLLEF
DPNKRWSPLQALYHPFITGESFTGPYEPVPETARIPVARAAAIDHNPGGG
HWLHSGLSPQVGSVNRYLPVNNAYPPKVPFSYGSSYGSYGSYTGNPGFGN
SYGSTGDVNAINMYYSPLGSSGLAQIGSSPDVRLRMRFPHDRGIRLSPGS
LGPMSLGASPSQFTPPNYQMQIPANSTGKHGSGSPASGGIHGSPLGKAAA
VGPYNMRRNLPMPPNDYVSQHGQGRFGDGVSFSHSDAYARGHTGHSHNAA
GPSSCHSGWRPQIGSRSGISLEASSSHVPSQAPSQSFDFSASSELDPANW
DPNYSDESLLQEDNSLSADLSSNLHFGDAGGQGS*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0004672protein kinase activity
GO:0005524ATP binding
Vocabulary: Biological Process
TermDefinition
GO:0006468protein phosphorylation