Sh_020L15_p000120

Overview
NameSh_020L15_p000120
Unique NameSh_020L15_p000120
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length343
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_020L15contigSh_020L15:75990..79676
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
EC5.1.3.15
InterProIPR025532
InterProIPR011013
InterProIPR008183
InterProIPR014718
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_020L15_t000120Sh_020L15_t000120R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_020L15_p000120 ID=Sh_020L15_p000120|Name=Sh_020L15_p000120|organism=R570 Sugarcane cultivar|type=polypeptide|length=343bp
MATAPSSSTPPTPHLPSMERRKGPTGLEKLVLRESRGWSAEVHLYGGQVT
SWKNDHGDELLFVSSKAIFKPPKAIRGGIPICFPQFGTHGNLEKHGFARN
RFWSIDDNPPPFPVNTAIKTFADLILKPSEEDLKIWPHSFEFRLRVALAP
RGDLILTSRIRNTNIDGRPFSFTFAYHTYFLVSDISMRVHDKLLDHRKRV
RHFSFMVRVEGLETLDYLDNLNAKRRFTEQGDAIVFEAEIDKIYLDVPSK
VAIIDHEKKRTYVLRKDGLLDTVLWNPWDKRSKIMQDLGDEEYKHMLCVE
PAAVEKPITLKPGEEWKGKMELTAVPSSYCSGQLDPEKVLQG*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0003824catalytic activity
GO:0030246carbohydrate binding
GO:0016853isomerase activity
Vocabulary: Biological Process
TermDefinition
GO:0005975carbohydrate metabolic process