Sh_020L15_p000130

Overview
NameSh_020L15_p000130
Unique NameSh_020L15_p000130
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length373
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_020L15contigSh_020L15:82644..84091
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR013083
InterProIPR001841
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_020L15_t000130Sh_020L15_t000130R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_020L15_p000130 ID=Sh_020L15_p000130|Name=Sh_020L15_p000130|organism=R570 Sugarcane cultivar|type=polypeptide|length=373bp
MDEHMGRRTVGGLLFTKGGSILLFREDGSRPKAKNCCSRHGYSGQHSTDK
AKGKEVRRVAAPNESTPATPGRSQIFRKPNRKPPHESSASGSISRDAGGS
CSETGSRSRDTPGRDLLARLKERVNTSRKRSLNRENSPQSPSGFSASSPS
NSRSVTRPSHRAASRIRKADEGANAGAADGMHRNGAGDARRSSERSDDDL
LLVEQVTRNHVPSEGFLSGFMARYRSGLQGELSSLDDSMEDSNGYLRFDV
GGIEELENYFIFNDRHRGMRMDIDGMSYEELLALGERIGTVNTGLSDCAL
STCLNRSLYMPTASGSHEDCERKCSICQEEYLAGEEVGKMACKHYYHLSC
IQHWLRQKNWCPICKSVALKIN*
back to top