Sh_020L15_p000150

Overview
NameSh_020L15_p000150
Unique NameSh_020L15_p000150
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length59
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_020L15contigSh_020L15:97279..97455
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_020L15_t000150Sh_020L15_t000150R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_020L15_p000150 ID=Sh_020L15_p000150|Name=Sh_020L15_p000150|organism=R570 Sugarcane cultivar|type=polypeptide|length=59bp
MLLKLWSIHAERIVVLVRYLSRYRGPSLHAKGPIGPCSAWVIYYTEGPYI
RMGRSLSI*
back to top